Section
News
13,704 posts in this section. RSS feed.
- news
SICILIA – LA BOLLITA DEL TONNO 2026 – IL 21 GIUGNO SULLA VIA DEL MARE DI OLIVERI
Tra cantori del mare, mastro d’ascia, ultimo tonnaroto e una fatica rituale che tiene uniti i lavoratori delle acque tirreniche, c’è un appuntamento irresistibile che riaccende le luci del borgo di Oliveri: “LA BOLLITA DEL TONNO 2026” – IL 21 GIUGNO SULLA VIA DEL MARE DI OLIVERI. La pesca come sostentamento e convivialità che esiste […]
by Redazione3 viewscomunicati-stampanewseventi-a-olivierifeaturedla-bollita-del-tonno-2026tonnara - news
Glencadam appoints new Distillery Manager
The Highland based Glencadam Distillery has announced the appointment of its new Distillery Manager, marking the next phase in its growth following the distillery’s 200th anniversary celebrations. Will Stafford, formerly Distillery Manager and Head Distiller at Hinch Distillery in County Down, Northern Ireland, from 2021 to 2026, brings more than 14 years of experience in […]
by Steve Rush1 viewnews - news
1892 Château d’Yquem Discovery at Czech Castle
Rare Château d’Yquem Bottles Unearthed After Decades Hidden Underground The 1892 Château d’Yquem discovery has captivated collectors and investors across... The post 1892 Château d’Yquem Discovery at Czech Castle appeared first on Cru Wine Fine Wine & Spirits Merchant .
by jane bachicha3 viewsall-about-winearticleswine - news
Home Fields Wine Launches New 500mL Glass Bottle Format
Wairarapa wine producer Home Fields Wine has lunched a new 500mL glass bottle format, perfectly sized for modern life. Owned and operated by Caroline and Brent Eddy, Home Fields Wine operates from their own vineyard, plus a family of boutique heritage sites they farm in Wairarapa. Why The 500mL Format? ‘We have more information on […]
by JB Wine Guy3 viewsfeatured-promotion500ml-bottleschardonnayhome-fields-winepinot-noirwairarapa - news
Wine merchant extends historic mine-water heat project
Lanchester Wine Cellars Ltd, the first private business to use mine water heat in Great Britain, has announced a new access agreement with the Mining Remediation Authority. The post Wine merchant extends historic mine-water heat project appeared first on Fruit & Vine .
by Alfie White1 viewvine - news
When is the Best Time to Visit Portugal? Seasonal Guide & Tips
Planning a trip to Portugal but unsure when to go? From the sun-drenched coastlines to the autumn grape harvests, here is your definitive seasonal guide to experiencing the very best of the country.
by consultantwintp17@gmail.com (Alexandra Monteiro)3 viewsbest-time-to-visit-portugalportugal-travel-guide-2026douro-valley-best-time-to-visitportugal-tourism-guideportugal-itinerary-planningvip-travel-portugal - news
Mike And Matt Taste Short Barrel Four Grain Bourbon
Short Barrel Bourbon was created by Adam Dorfman, Clinton Dugan and Patrick Lemmonond in 2015 in Atlanta, Georgia. In 2020, they sourced some Bourbon and created the Short Barrel Brand. In 2023, they purchased the Old Fourth Distillery in Atlanta,... Continue Reading →
by Michael R. Veach2 viewstasting-notesshort-barrel-four-grain-bourbon - news
Il futuro della birra artigianale in Italia. Cosa aspettarsi nei prossimi anni e come cambierà nei pub
Il futuro della birra artigianale sarà fatto di qualità, identità, formazione e clienti più consapevoli. Ecco come cambieranno i pub.
by Francesco Selicato2 viewsnozioni - news
Picnics in the Vines: Vineyard Picnics for National Picnic Week
Celebrate National Picnic Week with a vineyard picnic - from luxury hampers to BYO blankets among the vines.
by cellardoorteam2 viewseditorial - news
Canada 5000L Mixing Tanks
To meet the mixing requirements of a wastewater treatment project, a Canadian customer customized four 5000L mixing tanks from MICET. The tanks are primarily used for wastewater collection and mixing, improving liquid uniformity through continuous agitation and providing stable conditions for subsequent sedimentation, filtration, and biological treatment processes. Based on the customer’s site conditions and […]
by Micet1 viewmicet-craft-project-cases - news
The Copper Giant – Jamaikas funky Hochester-Koloss von whic
Mit The Copper Giant startet whic die eigene Rum-Serie Steambound – eine Saga in dreizehn Single-Cask-Abfüllungen, von denen jede ein Kapitel erzählt. Den… Der Beitrag The Copper Giant – Jamaikas funky Hochester-Koloss von whic erschien zuerst auf WHISKYFANBLOG.DE .
by Jörg Bechtold4 viewsnewsnotesjamaicanavy-strengthpedro-ximenezquarter-cask - news
Buxton Brewery appoints new CFO and targets growth
Buxton Brewery, one of the Peak District’s best known breweries, has recruited a new Chief Financial Officer (CFO) and is targeting a £10m turnover. Matthew Peck is joining in the role of CFO and brings more than a decade of senior financial leadership experience across high-growth, multi-site retail and hospitality businesses. He joins Buxton Brewery...
by Tim1 viewnewsbuxton-brewerycfogrowthpeak-districtturnover - news
Summer in the Garden
My reaction to beer with weird stuff in it has evolved from "Wow! This is exciting" to "Ugh! This is stupid" to "Wow! Somebody is still doing this". Today's set is from Zagreb's Garden Brewing, and I drank them in an attempt to recreate the youthful sensation of finding off-kilter beer interesting. I didn't notice until after I bought them that the brewery has put them in sequence, and first of four is Imperial Strawberry & Vanilla Milkshake IPA . It's so long since I've had a milkshake IPA that I was expecting it to pour pink, but it's actually a more orthodox golden shade, and only slightly hazed. It's a brave move to name Magnum, Citra and Mosaic as the hops, yet it does really smell like an IPA, with lots of citrus zest, next to low-key strawberry blancmange pudding. "Super creamy" they say, but the first sensation I got on sipping was clean fizz and quite a light body for 7.4% ABV. The hops have very much taken a back seat, and it tastes like a lurid-pink pre-packaged single-s
by noreply@blogger.com (The Beer Nut)0 viewsamerican-ipa-prysma-showcasegin-and-tonic-sourimperial-banana-breadimperial-strawberry-and-vanilla-milkshaketama - news
Local Brewing Co. returns as Hawthorn’s official beer partner
Image supplied by Local Brewing Co. " data-large-file="https://www.beerandbrewer.com/wp-content/uploads/2026/06/Hawks_Case_and_Cans_V6-12.png" /> Building on its successful 2025 release, the Melbourne brewery is bringing back its limited-release Hawks Lager. The post Local Brewing Co. returns as Hawthorn’s official beer partner appeared first on Beer & Brewer .
by Sienna Martyn2 viewscraft-beernewshawks-lagerlocal-brewing-coslider - news
Schramsberg J. Schramm Blancs 2016
Jacob Schram, a German immigrant, bought 200 acres on Mt. Diamond in Napa Valley in 1862 and planted 30,000 vines. He had Chinese laborers dig Napa’s first hillside caves for wine aging and storage. His winery, Schramsberg, gained fame after the author Robert Louis Stevenson wrote about it in his 1883 book, The Silverado Squatters.…
by Stephen Hawk2 viewssparkling-wine-newshugh-daviesschramsbergschramsberg-j-schrammschramsberg-j-schramm-blancsschramsberg-j-schramm-blancs-2016 - news
Aperol or Apritzo Spritz Recipe Using Cask Wine (From Aldi) (New Aperol Impressence Essence)
<div class="bbWrapper">Aperol Spritz is one of thos really popular drinks that have been sold around cool bars for some time and we really wanted to come up with a simple recipe so you guys can make your own Aperol Spritz so we wanted to start a thre
by KegLand-com-au0 viewsnon-beer-brewing - news
Fresh Brew: Your Monthly Digest of Top Forum Discussions – June 2026
Most Discussed Topics Accurate Description Controversy: Hefeweizen Phenols are NOT Cloveby Mont Y. Märzen with 36 posts this monthLook, I get this style has been made for well over 500 years. I'm not arguing with German brewers. But I can't for the life of me figure out how they think that the phenols in this […] The post Fresh Brew: Your Monthly Digest of Top Forum Discussions – June 2026 first appeared on Brewer's Friend .
by Larry1 viewuncategorized - news
Scapegrace Vanguard / Anthem (2025)
A review of the Scapegrace Vanguard and Scapegrace Anthem, two single malt whiskies from New Zealand.
by Thijs Klaverstijn3 viewsreviewsnew-zealandscapegraceanthemvanguard - news
Jeremias Boquete: NOXE Barcelona (Barcelona)
Jeremias Boquete is the bar director of NOXE Barcelona in W Hotel, Barcelona. He makes us two cocktails, one with vodka and shiitake and the second with fino sherry and mezcal. Jeremias introduce yourself I started my career as a bartender more than eight years ago, working behind the bars of nightclubs and high-energy venues ... More →
by Le Cocktail Connoisseur5 viewsnon-classebarbarcelonabartenderbeetrootbitter - news
Irish Whiskey Around The World, No 125, Innis & Gunn
It might seem odd to do an Irish Whiskey Around The World on a beer – but hear me out. Well known Scottish brewers Innis & Gunn have specialised in Barrel Aged Beers & clearly had to have an Irish Whiskey Cask version in their range. I never actually saw this bottle for sale in … Continue reading Irish Whiskey Around The World, No 125, Innis & Gunn →
by Whiskey Nut3 viewsbarrel-aged-beersirish-whiskeybarrel-aged-beerbrew-dogcollapseinnis-gunn - news
Focus alcol-salute | Un nuovo studio di Nature. È finita l’epoca delle semplificazioni
Nel dibattito sull’alcol e la salute convivono da anni due semplificazioni opposte . La prima è quella, ormai logora, secondo cui un consumo moderato – il famoso bicchiere di vino al giorno – farebbe bene alla salute. La seconda, più … continua »
by Tommaso Ciuffoletti2 viewsprimo-pianoalcoolalcool-salutedose-minima-sicurafocus-alcoolnature - news
A tasting a century in the making – trying a 100 year-old Champagne forgotten in the cellar of France's most famous chef
Our Champagne correspondent was invited to Ruinart for an incredible vertical tasting of eight wines spanning 100 years.
by Tom Hewson4 viewsfrancechampagnewinewine-regionswestern-europe - news
Taking the road west of Melbourne to discover Victoria's best-kept wine secret – Geelong and the Bellarine Peninsula
Small and mighty...
by Rosamund Hall1 viewaustraliavictoriawinewine-regions - news
Why Burgundy's Hautes-Côtes will be the region's next 'big thing'
Burgundy's appellations of the future...
by Charles Curtis MW3 viewsburgundywinewine-regionswestern-europefrance
