Section
News
13,532 posts in this section. RSS feed.
- news
Maryland Wine Country
Maryland Wine Country Maryland has been a historic and significant state in the development of American wine. The first wine was made there in 1648, and in 1662 Governor Charles Calvert planted 200 acres of vinifera grapes. The first book on viticulture and winemaking was published in 1823, and just over a century later, in ... Read more
by Editor2 viewsfrom-the-webfrom-the-web-featured - news
Summer 2026 Issue Preview
What You’ll Find Inside: Summer Issue 2026Ahhh, the summer months—a time when the sun shines (mostly), the weather turns warmer, and the whiskey cocktails get a little stronger. For our cover story, we go beyond the bourbon trail. As much as we love to partake in the bourbon trail activities, there are things to do…
by Lisa Konicki4 viewsall-postscoverfeaturedbourbon-plusbourbon-trailcover-story - news
Uncle Nearest Receiver Wants To Sell Company Plus Other News
By Richard Thomas Although it was my intention to not do another round-up of the whiskey industry’s closure, bankruptcy, business and lawsuit news until early summer, recent events have compelled me to follow mid-May’s update with a mid-June update. Double Blow To The Weavers In Uncle Nearest Case Sometimes small town newspapers are an excellent …
by Editor4 viewsbourbon-whiskeyfeaturedirish-whiskeytennessee-whiskeybourbonwhiskey-news - news
Looking Back
Twice a year, I help to organise a wine dinner for a group of friends. For the most recent one, in Paris, my job was to bring the sweet wines and a selection of Grenaches. In preparation, I looked at what I have in bond and had a selection delivered to my house. Coravin in […]
by Editor2 viewsfrom-the-webfrom-the-web-featured - news
Johnnie Walker Toasts Knicks Championship With Limited-Edition NYC Whisky
The Knicks’ finals win has swept the streets of New York City with a wave of hype, awe and once-in-a-lifetime camaraderie. So what better brand to throw its hat into the ring than a quintessentially Scottish whisky distiller? On Thursday, Johnnie Walker unveiled a limited-edition reimagining of its Blue Label bottling, the most expensive offering […]
by Pedro Wolfe3 viewsscotchjohnnie-walkerrelease - news
ONE CUISINE - Countless Flavours
Enjoy Italian flavours at Wander Food & Wine throughout June and then head to the Caruso Club July 3rd to 5th for the 54th Annual Società Caruso Italian Festival for a weekend filled with food, music, culture and community. UNESCO has officially recognized Italian cuisine as an Intangible Cultural Heritage, honouring the traditions, recipes and family gatherings that have brought people together for generations. What better time than Italian Heritage Month to celebrate the only cuisine in the...
by Wander0 views - news
📺 The Vine Bar Story
Ever wonder how Vine Bar came to be? Owner Justina Latura shares the story behind it all!
by Editor2 viewsfrom-the-webfrom-the-web-featured - news
Why Vineyard Managers Are Looking at Bioherbicides as Part of Their Weed Management Programs
Vineyard managers are constantly balancing labor efficiency, operational demands, site conditions, and weed management objectives. As the industry continues to evolve, many vineyards are exploring...
by Editor1 viewviticulture-growersps-news-viticulture - news
An Extra Set of Eyes in the Vineyard – How a Napa winemaker uses real-time data to manage water, protect fruit, and stay focused on the wine.
Roy has spent years producing high-quality wines with a focus on sustainable practices, always working to balance vine health against careful water use. It was visibility, knowing what was happening across the vineyard in real time, and being able to act on it without losing precious hours.
by Editor1 viewviticulture-growersps-news-viticulture - news
Winery SMS Marketing: 9 Proven Ways Wineries Are Using Text Messaging to Increase Club Sales, Improve Customer Experience, and Drive Revenue
Text messaging has evolved far beyond promotional blasts and last-minute event reminders.Today's most successful wineries are using SMS throughout the customer journey—from recovering wine club...
by Editor3 viewssales-marketingps-news-sales-marketing - news
Why the Analog Economy Could Be Wine’s Biggest Opportunity in 20 Years
The Wine Industry Supplier Network is the go-to resource for winery and vineyard professionals to discover, research, and connect with trusted suppliers and service providers...
by Editor3 viewssales-marketingps-news-sales-marketing - news
Saving Money in a Hard Year Starts With the Barrels You Already Own
As new barrel costs continue to rise, Barrel Blasting provides wineries with a practical, cost-effective solution for maintaining quality while maximizing the value of existing barrel inventories. Using a proprietary dry ice blasting process, we restore the interior working surface of wine barrels by removing heavy tartrates, embedded residue, and wine-saturated surface wood without water, chemicals, or secondary waste.
by Editor1 viewproduction-winemakingps-news-production - news
What Happens After Installation Matters Most
When wineries invest in automation, they're investing in efficiency, productivity, and long-term growth. But the true value of that investment depends on the support that...
by Editor1 viewproduction-winemakingps-news-production - news
Why TTB Labels Get Rejected — and How to Catch It Before You File
COLAClear pre-checks your wine label against 30+ compliance checks drawn straight from the federal regulations — mandatory statements, type sizes, prohibited claims, varietal and appellation truthfulness — before you ever file with TTB. Most TTB label rejections don't come from big mistakes.
by Editor1 viewoperations-leadershipps-news-operations - news
untitled
When wineries invest in equipment upgrades, facility expansions, or production improvements, flooring is rarely at the top of the priority list.Yet winery floors are subjected...
by Editor1 viewoperations-leadershipps-news-operations - news
Highland Park Brewery is Popping Up in the San Juan Islands This Summer
Bob Kunz, the owner of Highland Park Brewery, and his partner, Tiff, are coming to Orcas Island this summer, and they’re bringing beer. They’ll operate a beer garden at Lone Pine Larder starting on July 1st and lasting through the summer (until the end of August).
by Kendall Jones2 viewsbeer-newsfeatured-eventsfeatured-for-news-tickerhighland-park-brewery - news
Azur Associates Wine Market + M&A Review
Join Azur Associates for an exclusive discussion of their latest Wine Market + M&A Review. This focused webinar examines the forces reshaping the wine industry—from the ongoing demand reset and [...]
by Editor2 viewsfeaturedwin-webinarsazur-associatesdale-strattondanny-bragerpat-delong - news
Castle Rock Winery Earns Two 90-Point Ratings from James Suckling for Sauvignon Blanc and Zinfandel
June 18, 2026 (Rolling Hills, CA) — Castle Rock Winery is pleased to announce that two of its latest releases have earned 90-point ratings from internationally acclaimed wine critic James [...]
by Press Release2 viewsindustry-news-releaseswine-businesscastle-rock-winery - news
Building up sustainable wineries: from wine kegs to solar power
Treasury Wine Estates is advancing sustainability through initiatives such as reducing glass bottle weight, introducing wine kegs, and investing in solar energy.
by Editor2 viewsfrom-the-webfrom-the-web-featured - news
Cantine Maschio Prosecco Brut Review
A nice example of Prosecco at a reasonable price, we review the Cantine Maschio Prosecco Brut. Prosecco from the Prosecco ... Read more
by Jon Thorsen5 viewssparkling-winegleraitalyproseccothanksgivingvegan - news
Cambio ai vertici di Famiglie Storiche e Bottega Vini
È tempo di passaggi di consegna in casa Famiglie Storiche e Antica Bottega del Vino. L’Associazione che riunisce tredici tra le più radicate e autorevoli aziende vitivinicole della Valpolicella ha ufficializzato l’elezione di Luca Speri dell’azienda Speri Viticoltori alla sua presidenza, mentre Giacomo Boscaini di Masi Agricola... L'articolo Cambio ai vertici di Famiglie Storiche e Bottega Vini proviene da oscarwine .
by redazione2 viewsnewsamaroneanticabottegadelvinofamigliestorichegiacomoboscainilucanicolis - news
Detox Alcohol: Timeline, Symptoms & Safe Withdrawal Guide
When you decide to detox alcohol from your system, you’re taking the first critical step toward recovery—but it’s important to understand that alcohol detoxification is a medical process that requires professional supervision. Alcohol detox typically takes 5-10 days for acute physical withdrawal symptoms to resolve, though the timeline varies based on your drinking history, overall […] The post Detox Alcohol: Timeline, Symptoms & Safe Withdrawal Guide appeared first on Nova Recovery Center Near Austin Texas .
by NovaU SEO BOT4 viewsalcohol-abusedetoxrecoverysubstance-abuse - news
Wine Market Council Launches New Study on Wine Communication Across Generations
June 18, 2026 (Napa, CA) — Wine Market Council (WMC) today announced a new research initiative titled, “Engaging the Modern Wine Consumer: Communication Strategies for Gen Z, Millennials, and Gen [...]
by Press Release2 viewsindustry-news-releaseswine-businesswine-market-council - news
‘Drastic Dave’ begins Diageo restructure
Diageo has addressed a report that CEO Dave Lewis will cut jobs at the British drinks firm, and confirmed the departure of its UK managing director The post ‘Drastic Dave’ begins Diageo restructure appeared first on The Spirits Business.
by Editor2 viewsfrom-the-webfrom-the-web-featured