Topic
#malbec
22 posts tagged with this topic. RSS feed.
- news
Hester Creek’s 2024 Petit Verdot Malbec Delivers Bold Character and Remarkable Balance
Reading Time: 3 minutes Hester Creek's Columbia Valley Collection continues to impress with its 2024 Petit Verdot Malbec. Sourced from Washington's acclaimed Red Mountain AVA and crafted entirely in Oliver, this bold, beautifully balanced blend delivers exceptional value at 91 points. The post Hester Creek’s 2024 Petit Verdot Malbec Delivers Bold Character and Remarkable Balance appeared first on BCWineTrends .
by Julian0 viewsoliver-osoyoos-winerymalbecpetit-verdot - news
Zuccardi Q Malbec Review
Dark, deep and serious. We review the Zuccardi Q Malbec from the Uco Valley of Mendoza, Argentina. 100% Malbec from ... Read more
by Jon Thorsen0 viewsargentinamalbec - news
Finca La Igriega focusses on local Identity in Paraje Altamira, Argentina | Britt on Forbes
Mendoza in Argentina has made a huge success of growing malbec and selling it to the world. It started at the end of the 1980s. Malbec from Argentina became a brand. For a while, everyone was happy, producers as well as consumers. But things have changed. The grape is no longer enough. Now, ambitious producers […] Continue reading: Finca La Igriega focusses on local Identity in Paraje Altamira, Argentina | Britt on Forbes The post Finca La Igriega focusses on local Identity in Paraje Altamira, Argentina | Britt on Forbes was originally published on BKWine Magazine and written by Britt Karlsson . Copyright BKWine and BKWine Magazine. If you see it published elsewhere in full it has been republished without our permission. BKWine Magazine - Wine on the internet since 1996 Read more: On BKWine’s Wine Tours: Wine and food tours to the world’s wine regions | BKWine Tours Om BKWines Vinresor och matresor: Världens bästa vinresor och matresor | BKWine Vinresor On BKWine’s Wine Photography: Ph
by Britt Karlsson0 viewswine-producer-profilesargentinaforbesmalbecmendozauco-dalen - news
Terrazas De Los Andes Unveils Extremo Malbec 2022 in the US
The most elevated expression of the winery’s Ascension Journey is crafted from a single parcel in Gualtallary at 1,650 meters above sea level Terrazas de los Andes, a pioneer of [...]
by Press Release1 viewindustry-news-releaseswine-businessargentinalucas-lowimalbecmendoza - news
Two French Red Blends: Chateau Daviaud and M. Chapoutier Belleruche_PR SAMPLE
I recently decided to review two French red wines that are blends. Blends have the benefit that two or more grape varieties together fill in the weakness of the other grape. For example, one grape may be fruity but lack tannins, while another grape has plenty of tannins but lacks much fruit character. Putting the two grape varieties together makes...
by mywinepal3 viewsbordeauxcabernet-franccabernet-sauvignonfrancegrenachemalbec - news
Wendouree Cabernet Malbec 2017 Review
This wine is Wendouree’s cabernet sauvignon and malbec blend from the 2017 vintage and the Clare Valley in Australia. Wendouree […] The post Wendouree Cabernet Malbec 2017 Review appeared first on Grape Observer Wine Review .
by Sean Mitchell2 viewswine-reviewsaustraliacabernet-sauvignonclare-valleymalbecsouth-australia - news
Kirkland Signature Malbec – A Winner For $7
Bulk Buy! The latest vintage of the Costco Kirkland Signature Malbec hits it out of the park once again. 100% ... Read more
by Jon Thorsen4 viewskirkland-signatureargentinabulk-buycostcomalbecwedding-wine - news
St Johns Wine Round Puzzle Cabernet Malbec Merlot 2022
Bold and unapologetically rustic, this Bordeaux-style blend offers power and savoury depth in equal doses. Opening with a rush of drunken plums, ripe blackberries and evocative Black Forest cake, savoury notes of charred wood, barbecue smoke and crushed granite build anticipation. Firm and muscular to taste, the dense fruit is wrapped in a sheet of tense, dusty tannins. Structured rather than plush, layers of black pepper spice and charcoal peer through the mid-palate. Some granite-like minerality adds detail, offering tension and focus that carries through to a dry, gripping finish. Sit this beside a slab of protein and you're winning. It's nicely done. 91/100 Region: Blackwood Valley RRP: $40 Source: Sample Winery Website Subscribe to Qwine here Follow: Instagram , LinkedIn and X
by noreply@blogger.com (Unknown)5 views40-502290-94ptsblackwood-valleyblendscabernet-sauvignon - news
Nannup Estate Firetower SMT 2022
I recently received a few wines from the Blackwood Valley's Nannup Estate as I explore the district from the comfort of my east coast abode. Two wines down from this producer and they've delivered two rippers. This Shiraz Malbec Tempranillo nails the brief for great drinking. No information was received about the percentages in the blend, but that almost seems irrelevant when the going is good and the delish factor is high. Crushed purple petals set the tone. It's a wine with a rustic presence but polished with bevelled edges. Plums, mulberries and blueberries offer plenty of interest and depth with black earth and a notable minerally vibe. A faint eucalyptus note raises its hand with a neat dusting of dark chocolate crumb. Tense tannins soften over a couple of days. Built for food, it will take down some robust protein with ease. A terrific blend and rock-solid example of pleasure all for 28 bucks. 92/100 Region: Blackwood Valley RRP: $28 Source: Sample Winery
by noreply@blogger.com (Unknown)4 views20-302290-94ptsblackwood-valleyblendsmalbec - news
Nannup Estate Rolling Hills Malbec 2022
Smart drinking. A Malbec with great fruit and shape, find me a cozy place on a cold night and a generous glass. Plush plummy fruit leads the way with ripe mulberries and hints of blueberries framing the edges adding lift. Beneath the fruit lies an earthy core threaded with fruit bun spices that cling to a persistent finish. Dusty and cocoa tannins are tense and add some chew. Thoroughly enjoyable, this is great stuff. 92/100 Region: Blackwood Valley RRP: $38 Source: Sample Winery Website Subscribe to Qwine here Follow: Instagram , LinkedIn and X
by noreply@blogger.com (Unknown)4 views30-402290-94ptsblackwood-valleymalbec - news
Mount Mary Quintet 2022 Review
Mount Mary are one of the Yarra Valley’s leading producers. The “Quintet” is their most famous wine, and is capable […] The post Mount Mary Quintet 2022 Review appeared first on Grape Observer Wine Review .
by Sean Mitchell5 viewswine-reviewsaustraliacabernet-franccabernet-sauvignonmalbecmerlot - news
INSIDER DEAL! 96-Point Reta Romelio XX% OFF!
Say hello to a massive discount on this highly rated wine from Chile, today’s deal is the 2020 Reta Romelio ... Read more
by Jon Thorsen3 views10chiledealsinsider-dealsmalbecsaturday-splurge - news
Member’s Mark Mendoza Malbec Review
Inexpensive Malbec from Sam’s Club, but does it measure up? We review the Member’s Mark Mendoza Malbec. Malbec from Mendoza, ... Read more
by Jon Thorsen6 viewsargentinahighly-recommendedmalbecsam-s-club - news
Yeringberg 2013 Review
Yeringberg are one of the Yarra Valley’s leading producers. Their history is, more or less, the history of the Yarra […] The post Yeringberg 2013 Review appeared first on Grape Observer Wine Review .
by Sean Mitchell4 viewswine-reviewsaustraliabordeauxcabernet-franccabernet-sauvignonmalbec - news
Malbec Goes Well with Foods That Already Pair Perfectly with Beer: Where Does This Wine Have the Edge?
Discover how Malbec can enhance your dining experience, pairing perfectly with smoky dishes and rich flavors. Read More
by Gus Hall3 viewsbeyond-texasbeermalbec - news
La Posta Angel Paulucci Malbec 2023 Review
This wine is from Laura Catena and labelled as “La Posta” and “Paulucci”. It’s a malbec from Mendoza in Argentina […] The post La Posta Angel Paulucci Malbec 2023 Review appeared first on Grape Observer Wine Review .
by Sean Mitchell5 viewswine-reviewsargentinamalbecred-winewinewine-review - news
Weekly Cellar Round-Up
Over the course of a week, I taste a bunch of wine, usually with friends, and almost always with my wife. Here are some of the wines we tasted over the past few weeks. These are wines that were not sent … Continue reading →
by the drunken cyclist4 viewsbordeauxbordeaux-blendburgundycabernet-sauvignoncaliforniachardonnay - news
Marvelous Malbec
<p>Took a chance with this, although not too much of a chance, as I thought it would be good and blimey was it!</p><p>I was lucky to find a few bottles of this in the recent Christmas promotion at Waitrose, when they were offering their £10 Fine Wine
by Dave Cronin aka VinoViews4 viewslove-lane-breweryargentinamendozamalbec - news
Malbec grape and wines
Guide to the Malbec Grape & its wines Malbec, Argentinian Malbec in particular, is one of the most popular red wines in the UK. It was long considered one of the ‘beefiest’ red wines and became a staple house wine for many pubs and restaurants, initially increasing its popularity. That may however have come at a cost as public perception of the quality of Malbec seems to be in decline. This blogpost looks into the reasons for Malbec’s popularity, explores facts about the Malbec grape that account, in part, for the wine’s different aromas & flavours and for the different styles of Malbec wine. It also considers if quality has become an issue for ‘brand Malbec’ and covers which food is best consumed with Malbec. The Malbec grape Although the Malbec grape is the flagship grape of Argentina, it originated in the area of South West France around the city of Cahors, east of Bordeaux and north of Toulouse. It is also known in that area and in the Loire where a little is grown as Côt or Auxerr
by WinesWithAttitude4 viewsgrape-varietieswine-stylesargentinafood-pairingmalbecwine-and-food - news
Exploring La Celia: A Premier Uco Valley Winery
Last week I attended a masterclass at the Institute of the Masters of Wine showcasing the very first winery in the Uco Valley, Mendoza, Argentina, La Celia. The current winemaker, Andrea Ferreyra has been making wines for Le Celia since 2006 and she was present to lead us through the masterclass. La Celia was founded […] The post Exploring La Celia: A Premier Uco Valley Winery appeared first on The Wine Sleuth .
by winesleuth5 viewsallargentinafeatured-postmalbecwinemaker - news
Shiraz, mostly
Penfolds Koonunga Hill Seventy Six Cabernet Shiraz 2006 . Opens hard and abrasive, but softens in time. Spiced Christmas pudding and shellac. Stylistically true to the house. I think this was the first release of the Seventy Six. I've written about it before . . . Then as now - I wonder - How finely/cynically can you segment the market when you ultimately offer only one sort of (red) wine - something dense, full, warm and old fashioned. . . SC Pannell Adelaide Hills Syrah 2012 . The 2013 edition went on to win the Jimmy Watson. This would be a tricky wine in a 100% blinded line up. It has a DMS / über black currant nose; thankfully I spotted the Burgundy bottle, bringing my formulation back to cool climate Shiraz. . . Full and plump, cherry ripe, with lovely fine inky tannins. Wolf Blass Black Label 2002. Shiraz, Cabernet and Malbec. Barossa and Langhorne Creek. From my cellar. Cork (50% stained). A whiff of glue and v/a to start, but then it's all lush oak (there's F
by noreply@blogger.com (Edward)4 views200220062012adelaide-hillsbarossacabernet-sauvignon - news
Jack Chapman’s vinous exploration of Argentina
Day 1 Have you ever flown from Heathrow to Buenos Aires with 30 wine merchants? It’s an experience I would recommend, although the lounge at Terminal 5 and British Airways might still be reeling from the drinks tab we managed to knock up. It’s a rare opportunity, that we get to visit any of the […]
by Jack Chapman6 viewsl-s-postargentinamalbecmendozanew-world-winesouth-america